(data stored in ACNUC10821 zone)

EMBL: AP010958.PE528

AP010958.PE528       Location/Qualifiers
FT   CDS             complement(584387..585484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0528"
FT                   /product="putative outer membrane porin protein"
FT                   /note="Prophage ECO103_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0528"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29395"
FT                   /db_xref="GOA:C8U2N7"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR001897"
FT                   /db_xref="InterPro:IPR013793"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2N7"
FT                   /protein_id="BAI29395.1"
FT                   /translation="MKKLTVAISAVAASVLMAMSAQAAEIYNKDSNKLDLYGKVNAKHY
FT                   FSSNDADDGDTTYVRLGFKGETQINDQLTGFGQWEYEFKGNRAESQGSSKDKTRLAFAG
FT                   LKFGDYGSIDYGRNYGVAYDIGAWTDVLPEFGGDTWTQTDVFMTGRTTGVATYRNNDFF
FT                   GLVDGLNFAAQYQGKNDRSDFDNYTEGNGDGFGFSATYEYEGFGIGATYAKSDRTDTQV
FT                   NAGKVLPEVFASGKNAEVWAAGLKYDANNIYLATTYSETQNMTVFADHFVANKAQNFEA
FT                   VAQYQFDFGLRPSVAYLQSKGKDLGVWGDQDLVKYVDVGATYYFNKNMSTFVDYKINLL
FT                   DKNDFTKALGVSTDDIVAVGLVYQF"
     MKKLTVAISA VAASVLMAMS AQAAEIYNKD SNKLDLYGKV NAKHYFSSND ADDGDTTYVR        60
     LGFKGETQIN DQLTGFGQWE YEFKGNRAES QGSSKDKTRL AFAGLKFGDY GSIDYGRNYG       120
     VAYDIGAWTD VLPEFGGDTW TQTDVFMTGR TTGVATYRNN DFFGLVDGLN FAAQYQGKND       180
     RSDFDNYTEG NGDGFGFSAT YEYEGFGIGA TYAKSDRTDT QVNAGKVLPE VFASGKNAEV       240
     WAAGLKYDAN NIYLATTYSE TQNMTVFADH FVANKAQNFE AVAQYQFDFG LRPSVAYLQS       300
     KGKDLGVWGD QDLVKYVDVG ATYYFNKNMS TFVDYKINLL DKNDFTKALG VSTDDIVAVG       360
     LVYQF                                                                   365
//

If you have problems or comments...

PBIL Back to PBIL home page