(data stored in ACNUC10821 zone)

EMBL: AP010958.PE530

AP010958.PE530       Location/Qualifiers
FT   CDS             586288..586785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0530"
FT                   /product="putative endolysin protein"
FT                   /note="Prophage ECO103_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0530"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29397"
FT                   /db_xref="GOA:C8U2N9"
FT                   /db_xref="InterPro:IPR002196"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2N9"
FT                   /protein_id="BAI29397.1"
FT                   /translation="MPPSLRKAVAAAIGGGAIAIASVLITGPSGNDGLEGVSYIPYKDI
FT                   VGVWTVCHGHTGKDIMLGKTYTKAECKALLNKDLATVARQINPYIKVDIPETTRGALYS
FT                   FVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGLMTRREIEREVCLWG
FT                   QQ"
     MPPSLRKAVA AAIGGGAIAI ASVLITGPSG NDGLEGVSYI PYKDIVGVWT VCHGHTGKDI        60
     MLGKTYTKAE CKALLNKDLA TVARQINPYI KVDIPETTRG ALYSFVYNVG AGNFRTSTLL       120
     RKINQGDIKG ACDQLRRWTY AGGKQWKGLM TRREIEREVC LWGQQ                       165
//

If you have problems or comments...

PBIL Back to PBIL home page