(data stored in SCRATCH zone)

EMBL: AP010958.PE534

AP010958.PE534       Location/Qualifiers
FT   CDS             complement(587859..588311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0534"
FT                   /product="hypothetical protein"
FT                   /note="Prophage ECO103_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0534"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29401"
FT                   /db_xref="InterPro:IPR009833"
FT                   /db_xref="InterPro:IPR036696"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2P3"
FT                   /protein_id="BAI29401.1"
FT                   /translation="MQTTRPRITWKVLPMAQVAIFKEIFDQVRKDLNCELFYSELKRHN
FT                   VSHYIYYLATDNIHIVLENDNTVLIKGLKKVVNVKFSRNTHLIETSFDRLKSREITFQQ
FT                   YRENLAKAGVFRWVTNIHEHKRYYYTFDNSLLFTESIQNTTQIFPR"
     MQTTRPRITW KVLPMAQVAI FKEIFDQVRK DLNCELFYSE LKRHNVSHYI YYLATDNIHI        60
     VLENDNTVLI KGLKKVVNVK FSRNTHLIET SFDRLKSREI TFQQYRENLA KAGVFRWVTN       120
     IHEHKRYYYT FDNSLLFTES IQNTTQIFPR                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page