(data stored in ACNUC10821 zone)

EMBL: AP010958.PE535

AP010958.PE535       Location/Qualifiers
FT   CDS             588555..588761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0535"
FT                   /product="hypothetical protein"
FT                   /note="Prophage ECO103_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0535"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29402"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2P4"
FT                   /protein_id="BAI29402.1"
FT                   /translation="MNKEQSADDPSVDLIRVKNMLNSTISMSYPDVVIACIEHKVSLEA
FT                   FRAIEAALVKHDNNMKDYSLVVD"
     MNKEQSADDP SVDLIRVKNM LNSTISMSYP DVVIACIEHK VSLEAFRAIE AALVKHDNNM        60
     KDYSLVVD                                                                 68
//

If you have problems or comments...

PBIL Back to PBIL home page