(data stored in ACNUC10821 zone)

EMBL: AP010958.PE536

AP010958.PE536       Location/Qualifiers
FT   CDS             complement(588926..589120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0536"
FT                   /product="conserved predicted protein"
FT                   /note="Prophage ECO103_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0536"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29403"
FT                   /db_xref="InterPro:IPR025030"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2P5"
FT                   /protein_id="BAI29403.1"
FT                   /translation="MSTKNRTRRTTTRNIRFPNQMIEQINIALDQKGSGNFSAWVIEAC
FT                   RRRLTSEKIAYTSIKSDEE"
     MSTKNRTRRT TTRNIRFPNQ MIEQINIALD QKGSGNFSAW VIEACRRRLT SEKIAYTSIK        60
     SDEE                                                                     64
//

If you have problems or comments...

PBIL Back to PBIL home page