(data stored in ACNUC10821 zone)

EMBL: AP010958.PE537

AP010958.PE537       Location/Qualifiers
FT   CDS             589509..590054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0537"
FT                   /product="terminase small subunit"
FT                   /note="Prophage ECO103_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0537"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29404"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010906"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2P6"
FT                   /protein_id="BAI29404.1"
FT                   /translation="MEVNKKQLADIFGASIRTIQNWQEQGMPVLRGGGKGNEVLYDSAA
FT                   VIKWYAERDAEIENEKLRREVEELRQASEADLQPGTIEYERHRLTRAQADAQELKNARD
FT                   SAEVVETAFCTFVLSRIAGEIASILDGLPLSVQRRFPELENRHVDFLKRDIIKAMNKAA
FT                   ALDELIPGLLSEYIEQSG"
     MEVNKKQLAD IFGASIRTIQ NWQEQGMPVL RGGGKGNEVL YDSAAVIKWY AERDAEIENE        60
     KLRREVEELR QASEADLQPG TIEYERHRLT RAQADAQELK NARDSAEVVE TAFCTFVLSR       120
     IAGEIASILD GLPLSVQRRF PELENRHVDF LKRDIIKAMN KAAALDELIP GLLSEYIEQS       180
     G                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page