(data stored in SCRATCH zone)

EMBL: AP010958.PE545

AP010958.PE545       Location/Qualifiers
FT   CDS             596930..597283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0545"
FT                   /product="putative minor capsid protein"
FT                   /note="Prophage ECO103_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0545"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29412"
FT                   /db_xref="GOA:C8U2Q4"
FT                   /db_xref="InterPro:IPR008018"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2Q4"
FT                   /protein_id="BAI29412.1"
FT                   /translation="MADFDNLFDAAIARADETIRGYMGTSATITSGEQSGAVIRGVFDD
FT                   PENISYAGQGVRVEGSSPSLFVRTDEVRQLRRGDTLTIGEENFWVDRVSPDDGGSCHLW
FT                   LGRGVPPAVNRRR"
     MADFDNLFDA AIARADETIR GYMGTSATIT SGEQSGAVIR GVFDDPENIS YAGQGVRVEG        60
     SSPSLFVRTD EVRQLRRGDT LTIGEENFWV DRVSPDDGGS CHLWLGRGVP PAVNRRR          117
//

If you have problems or comments...

PBIL Back to PBIL home page