(data stored in SCRATCH zone)

EMBL: AP010958.PE546

AP010958.PE546       Location/Qualifiers
FT   CDS             597295..597873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0546"
FT                   /product="putative minor capsid protein"
FT                   /note="Prophage ECO103_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0546"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29413"
FT                   /db_xref="InterPro:IPR010633"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2Q5"
FT                   /protein_id="BAI29413.1"
FT                   /translation="MAIKGLEQAVENLSRISKTAVPGAAAMAINRVASSAISQSASQVA
FT                   RETKVRRKLVKERARLKRATVKNPQARIKVNRGDLPVIKLGNARVVLSRRRRRKKGQRS
FT                   SLKGGGSVLVVGNRRIPGAFIQQLKNGRWHVMQRVAGKNRYPIDVVKIPMAVPLTTAFK
FT                   QNIERIRRERLPKELGYALQHQLRMVIKR"
     MAIKGLEQAV ENLSRISKTA VPGAAAMAIN RVASSAISQS ASQVARETKV RRKLVKERAR        60
     LKRATVKNPQ ARIKVNRGDL PVIKLGNARV VLSRRRRRKK GQRSSLKGGG SVLVVGNRRI       120
     PGAFIQQLKN GRWHVMQRVA GKNRYPIDVV KIPMAVPLTT AFKQNIERIR RERLPKELGY       180
     ALQHQLRMVI KR                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page