(data stored in ACNUC10821 zone)

EMBL: AP010958.PE547

AP010958.PE547       Location/Qualifiers
FT   CDS             597870..598265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0547"
FT                   /product="putative minor tail protein"
FT                   /note="Prophage ECO103_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0547"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29414"
FT                   /db_xref="InterPro:IPR009312"
FT                   /db_xref="InterPro:IPR035934"
FT                   /db_xref="InterPro:IPR038512"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2Q6"
FT                   /protein_id="BAI29414.1"
FT                   /translation="MKHTELRAAVLDALEKHDTGATFFDGRPAVFDEADFPAVAVYLTG
FT                   AEYTGEELDSDTWQAELHIEVFLPAQVPDSELDAWMESRIYPVMSDIPALSDLITSMVA
FT                   SGYDYRRDDDAGLWSSADLTYVITYEM"
     MKHTELRAAV LDALEKHDTG ATFFDGRPAV FDEADFPAVA VYLTGAEYTG EELDSDTWQA        60
     ELHIEVFLPA QVPDSELDAW MESRIYPVMS DIPALSDLIT SMVASGYDYR RDDDAGLWSS       120
     ADLTYVITYE M                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page