(data stored in ACNUC10821 zone)

EMBL: AP010958.PE548

AP010958.PE548       Location/Qualifiers
FT   CDS             598294..599013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0548"
FT                   /product="putative major tail protein"
FT                   /note="Prophage ECO103_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0548"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29415"
FT                   /db_xref="InterPro:IPR003343"
FT                   /db_xref="InterPro:IPR032494"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2Q7"
FT                   /protein_id="BAI29415.1"
FT                   /translation="MPVKGAGTTLWVYKGSGDPYANPLSDVDWSRLAKVKDLTPGELTA
FT                   ESYDDSYLDDEDADWTATGQGQKSAGDTSFTLAWMPGEQGQQALLAWFNEGDTRAYKIR
FT                   FPNGTVDVFRGWVSSIGKAVTAKEVITRTVKVTNVGRPSMAEDRSTVTAATGMTVTPSS
FT                   TSVVKGQSTTLTVAFQPEGVTDKSFRAVSADKTKATVSVSGMTITVNGVAAGKVNIPVV
FT                   SGNGEFAAVAEITVTAS"
     MPVKGAGTTL WVYKGSGDPY ANPLSDVDWS RLAKVKDLTP GELTAESYDD SYLDDEDADW        60
     TATGQGQKSA GDTSFTLAWM PGEQGQQALL AWFNEGDTRA YKIRFPNGTV DVFRGWVSSI       120
     GKAVTAKEVI TRTVKVTNVG RPSMAEDRST VTAATGMTVT PSSTSVVKGQ STTLTVAFQP       180
     EGVTDKSFRA VSADKTKATV SVSGMTITVN GVAAGKVNIP VVSGNGEFAA VAEITVTAS        239
//

If you have problems or comments...

PBIL Back to PBIL home page