(data stored in SCRATCH zone)

EMBL: AP010958.PE553

AP010958.PE553       Location/Qualifiers
FT   CDS             602337..602666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0553"
FT                   /product="putative minor tail protein"
FT                   /note="Prophage ECO103_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0553"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29418"
FT                   /db_xref="InterPro:IPR010265"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2R0"
FT                   /protein_id="BAI29418.1"
FT                   /translation="MKTFRWKVKPGMDVASVPSVRKVRFGDGYSQRAPAGLNANLKTYS
FT                   VTLSVPREEATVLESFLEEHGGWKSFLWTPPYEWRQIKVTCAKWSSRVSMLRVEFSAEF
FT                   EQVVN"
     MKTFRWKVKP GMDVASVPSV RKVRFGDGYS QRAPAGLNAN LKTYSVTLSV PREEATVLES        60
     FLEEHGGWKS FLWTPPYEWR QIKVTCAKWS SRVSMLRVEF SAEFEQVVN                   109
//

If you have problems or comments...

PBIL Back to PBIL home page