(data stored in ACNUC10821 zone)

EMBL: AP010958.PE555

AP010958.PE555       Location/Qualifiers
FT   CDS             603370..604113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0555"
FT                   /product="putative tail assembly protein"
FT                   /note="Prophage ECO103_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0555"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29420"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="InterPro:IPR028090"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2R2"
FT                   /protein_id="BAI29420.1"
FT                   /translation="MTETESAILAHARRCAPAESCGFVVRTPEGERYFPCVNISGEPEA
FT                   YFRMSPEDWLSAEMQGEIVALVHSHPGGLPWLSEADRRLQVQSDLPWWLVCRGAIHKFR
FT                   CVPHLTGRRFEHGVTDCYTLFRDAYHLAGIEMPDFHRGDDWWRHGQNLYLDNMEATGLY
FT                   QVPLSAAQPGDVLLCCFGSSVPNHAAIYCGDGELLHHIPEQLSKRERYTDKWQRRTHSL
FT                   WRHRAWHASAFTGICNDLVAVSTFV"
     MTETESAILA HARRCAPAES CGFVVRTPEG ERYFPCVNIS GEPEAYFRMS PEDWLSAEMQ        60
     GEIVALVHSH PGGLPWLSEA DRRLQVQSDL PWWLVCRGAI HKFRCVPHLT GRRFEHGVTD       120
     CYTLFRDAYH LAGIEMPDFH RGDDWWRHGQ NLYLDNMEAT GLYQVPLSAA QPGDVLLCCF       180
     GSSVPNHAAI YCGDGELLHH IPEQLSKRER YTDKWQRRTH SLWRHRAWHA SAFTGICNDL       240
     VAVSTFV                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page