(data stored in ACNUC10821 zone)

EMBL: AP010958.PE556

AP010958.PE556       Location/Qualifiers
FT   CDS             604011..604658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0556"
FT                   /product="putative tail assembly protein"
FT                   /note="Prophage ECO103_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0556"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29421"
FT                   /db_xref="GOA:C8U2R3"
FT                   /db_xref="InterPro:IPR010654"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2R3"
FT                   /protein_id="BAI29421.1"
FT                   /translation="MAATHTLPLASPGMARICLYGDLQRFGRRIDLRVKTGAEAIRALA
FT                   TQLPVFRQKLNEGWYQVRIAGRDAGENELSARLNEPLANGAVIHIVPRLAGAKSGGVFQ
FT                   VVLGAALIAVAWWNPVGWLGAAAVSGMYAAGASMILGGVAQMLAPKARTPTAASTDNGK
FT                   QNTYFSSLDNMVAQGNVLPVLYGEMRVGSRVVSQEISTADEGDGGQVVVIGR"
     MAATHTLPLA SPGMARICLY GDLQRFGRRI DLRVKTGAEA IRALATQLPV FRQKLNEGWY        60
     QVRIAGRDAG ENELSARLNE PLANGAVIHI VPRLAGAKSG GVFQVVLGAA LIAVAWWNPV       120
     GWLGAAAVSG MYAAGASMIL GGVAQMLAPK ARTPTAASTD NGKQNTYFSS LDNMVAQGNV       180
     LPVLYGEMRV GSRVVSQEIS TADEGDGGQV VVIGR                                  215
//

If you have problems or comments...

PBIL Back to PBIL home page