(data stored in ACNUC10821 zone)

EMBL: AP010958.PE557

AP010958.PE557       Location/Qualifiers
FT   CDS             604719..608117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0557"
FT                   /product="putative host specificity protein"
FT                   /note="Prophage ECO103_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0557"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29422"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR015406"
FT                   /db_xref="InterPro:IPR021034"
FT                   /db_xref="InterPro:IPR032876"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2R4"
FT                   /protein_id="BAI29422.1"
FT                   /translation="MGKGSSKGHTPREAKDNLKSTQLLSVIDAISEGPVEGPVDGLKSV
FT                   LLNSTPVLDSEGNTNISGVTVVFRAGEQEQTPPEGFESSGSETVLGTEVKYDTPITRAI
FT                   TSANIDRLRFTFGVQALVETTSKGDRNPSEVRLLVQIQRNGGWVTEKDITIKGKTTSQY
FT                   LASVVVDNLPPRPFNIRMRRMTPDSTTDQLQNKTLWSSYTEIIDVKQGYPNTALVGVKV
FT                   DSEQFGSQQVSRNYHLRGRILQVPSNYNPQTRQYSGIWDGTLKPAYSNNPAWCLWDMLT
FT                   HPRYGMGKRLGAADVDKWALYVIGQYCDQSVPDGFGGTEPRITCNAYLTTQRKAWDVLS
FT                   DFCSAMRCMPVWNGQTLTFVQDRPSDKVWTYNRSNVVMPDDGAPFRYSFSALKDRHNAV
FT                   EVNWIDPNNGWETATELVEDTQAIARYGRNVTKMDAFGCTSRGQAHRAGLWLIKTELLE
FT                   TQTVDFSVGAEGLRHVPGDVIEICDDDYAGISIGGRVLAVNSQTRTLTLDREITLPSSG
FT                   TTLISLVDGQGNPVSVEVQSVTDGVKVKVSRVPDGVAEYSVWGLKLPTLRQRLFRCVSI
FT                   RENDDGTYAITAVQHVPEKEAIVDNGAHFDGDQSGTVNGVTPPAVQHLTAEVTADSGEY
FT                   QVLARWDTPKVVKGVSFMLRLTVAADDGSERLVSTARTTETTYRFTQLALGNYRLTVRA
FT                   ANAWGQQGDPASVSFRIAAPAAPSRIELTPGYFQITATPHLAVYDPTVQFEFWFSEKRI
FT                   TDIRQVETTARYLGTGLYWIAASINIKPGHDYYFYIRSVNTVGKSAFVEAVGRASDDAE
FT                   GYLDFFKGKITESHLGKELLEKVDLTEDNASRLDEFSKEWKDANDKWNAMWGVKIEQTK
FT                   DGKHYVAGIGLSMEDTEEGKLSQFLVAANRIAFIDPANGNETPMFVAQGNQIFMNDVFL
FT                   KRLTAPTITSGGSPPVFSLTSDGKLTAKNADISGSVNANSGTLNNVTINENCQIKGKLS
FT                   ANQIEGDIVKTVSKSFPRTSTYASGTITVRISDDQKFDRQVMIPPVLFRGGKHENFNSN
FT                   NQQSYWYSTCRLRVTRNGQEIFNQSTTDAQGVFSSVIDMPAGQGTLTLTFTVSSSGANN
FT                   WTPTTSISDLLVVVMKKSTAGISIS"
     MGKGSSKGHT PREAKDNLKS TQLLSVIDAI SEGPVEGPVD GLKSVLLNST PVLDSEGNTN        60
     ISGVTVVFRA GEQEQTPPEG FESSGSETVL GTEVKYDTPI TRAITSANID RLRFTFGVQA       120
     LVETTSKGDR NPSEVRLLVQ IQRNGGWVTE KDITIKGKTT SQYLASVVVD NLPPRPFNIR       180
     MRRMTPDSTT DQLQNKTLWS SYTEIIDVKQ GYPNTALVGV KVDSEQFGSQ QVSRNYHLRG       240
     RILQVPSNYN PQTRQYSGIW DGTLKPAYSN NPAWCLWDML THPRYGMGKR LGAADVDKWA       300
     LYVIGQYCDQ SVPDGFGGTE PRITCNAYLT TQRKAWDVLS DFCSAMRCMP VWNGQTLTFV       360
     QDRPSDKVWT YNRSNVVMPD DGAPFRYSFS ALKDRHNAVE VNWIDPNNGW ETATELVEDT       420
     QAIARYGRNV TKMDAFGCTS RGQAHRAGLW LIKTELLETQ TVDFSVGAEG LRHVPGDVIE       480
     ICDDDYAGIS IGGRVLAVNS QTRTLTLDRE ITLPSSGTTL ISLVDGQGNP VSVEVQSVTD       540
     GVKVKVSRVP DGVAEYSVWG LKLPTLRQRL FRCVSIREND DGTYAITAVQ HVPEKEAIVD       600
     NGAHFDGDQS GTVNGVTPPA VQHLTAEVTA DSGEYQVLAR WDTPKVVKGV SFMLRLTVAA       660
     DDGSERLVST ARTTETTYRF TQLALGNYRL TVRAANAWGQ QGDPASVSFR IAAPAAPSRI       720
     ELTPGYFQIT ATPHLAVYDP TVQFEFWFSE KRITDIRQVE TTARYLGTGL YWIAASINIK       780
     PGHDYYFYIR SVNTVGKSAF VEAVGRASDD AEGYLDFFKG KITESHLGKE LLEKVDLTED       840
     NASRLDEFSK EWKDANDKWN AMWGVKIEQT KDGKHYVAGI GLSMEDTEEG KLSQFLVAAN       900
     RIAFIDPANG NETPMFVAQG NQIFMNDVFL KRLTAPTITS GGSPPVFSLT SDGKLTAKNA       960
     DISGSVNANS GTLNNVTINE NCQIKGKLSA NQIEGDIVKT VSKSFPRTST YASGTITVRI      1020
     SDDQKFDRQV MIPPVLFRGG KHENFNSNNQ QSYWYSTCRL RVTRNGQEIF NQSTTDAQGV      1080
     FSSVIDMPAG QGTLTLTFTV SSSGANNWTP TTSISDLLVV VMKKSTAGIS IS              1132
//

If you have problems or comments...

PBIL Back to PBIL home page