(data stored in SCRATCH zone)

EMBL: AP010958.PE560

AP010958.PE560       Location/Qualifiers
FT   CDS             611775..612338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0560"
FT                   /product="putative tail fiber assembly protein"
FT                   /note="Prophage ECO103_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0560"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29425"
FT                   /db_xref="InterPro:IPR003458"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2R7"
FT                   /protein_id="BAI29425.1"
FT                   /translation="MSEQPRTIKIYNLLAGTNEFIGEGDAYIPPHTGLPANSIDIAPPD
FT                   IPAGFVAVFNSDEASWHLVEDHRGKTVYDVASGDALFISELGPLPENVTWLSPGGEYQK
FT                   WNGTAWVKDTEAEKLFRIREAEETKNSLMQVASEHIAPLQDAVDLEIATEEETLLLEAW
FT                   KKYRVLLNRVDTSTAPDIEWPALP"
     MSEQPRTIKI YNLLAGTNEF IGEGDAYIPP HTGLPANSID IAPPDIPAGF VAVFNSDEAS        60
     WHLVEDHRGK TVYDVASGDA LFISELGPLP ENVTWLSPGG EYQKWNGTAW VKDTEAEKLF       120
     RIREAEETKN SLMQVASEHI APLQDAVDLE IATEEETLLL EAWKKYRVLL NRVDTSTAPD       180
     IEWPALP                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page