(data stored in ACNUC10821 zone)

EMBL: AP010958.PE564

AP010958.PE564       Location/Qualifiers
FT   CDS             614851..615156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0564"
FT                   /product="hypothetical protein"
FT                   /note="Prophage ECO103_P01"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0564"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29429"
FT                   /db_xref="InterPro:IPR003458"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2S1"
FT                   /protein_id="BAI29429.1"
FT                   /translation="MLPQHSDIEIAWYASIQQELNGWKTVTTQFYIQEFSEYIAPLQDA
FT                   VDLEIATEEERSLLEAWNKYRVLLNRVDTSVALGMKLFVTHVTVTVITISKVQNVY"
     MLPQHSDIEI AWYASIQQEL NGWKTVTTQF YIQEFSEYIA PLQDAVDLEI ATEEERSLLE        60
     AWNKYRVLLN RVDTSVALGM KLFVTHVTVT VITISKVQNV Y                           101
//

If you have problems or comments...

PBIL Back to PBIL home page