(data stored in SCRATCH zone)

EMBL: AP010958.PE571

AP010958.PE571       Location/Qualifiers
FT   CDS             complement(625777..626913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0571"
FT                   /product="putative H repeat-associated protein"
FT                   /note="RhsJ, IS677"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0571"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29436"
FT                   /db_xref="GOA:C8U2S8"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR032806"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2S8"
FT                   /protein_id="BAI29436.1"
FT                   /translation="MEFKKLMEHISIIPDYRQAWKVEHKLSDILLLTICAVISGAESWE
FT                   DIEDFGETHLDFLKQYGDFENGIPVHDTIARVVSCISPAKFHECFINWMRDCHSSNDKD
FT                   VIAIDGKTLRHSYDKSRRRGAIHVISAFSTMHSLVIGQIKTDEKSNEITAIPELLNMLD
FT                   IKGKIITTDAMGCQKDIAEKIQKQGGDYLFAVKGNQGRLNKAFEEKFPLKELNNPEHDS
FT                   YAISEKSHGREEIRLHIVCDVPDELIDFTFEWKGLKKLCVAVSFRSIIAEQKKEPEMTV
FT                   RYYISSADLTAEKFATAIRNHWHVENKLHWRLDVVMNEDDCKIRRGNAAELFSGIRHIA
FT                   INILTNDKVFKAGLRRKMRKAAMDRNYLASVLAGSGLS"
     MEFKKLMEHI SIIPDYRQAW KVEHKLSDIL LLTICAVISG AESWEDIEDF GETHLDFLKQ        60
     YGDFENGIPV HDTIARVVSC ISPAKFHECF INWMRDCHSS NDKDVIAIDG KTLRHSYDKS       120
     RRRGAIHVIS AFSTMHSLVI GQIKTDEKSN EITAIPELLN MLDIKGKIIT TDAMGCQKDI       180
     AEKIQKQGGD YLFAVKGNQG RLNKAFEEKF PLKELNNPEH DSYAISEKSH GREEIRLHIV       240
     CDVPDELIDF TFEWKGLKKL CVAVSFRSII AEQKKEPEMT VRYYISSADL TAEKFATAIR       300
     NHWHVENKLH WRLDVVMNED DCKIRRGNAA ELFSGIRHIA INILTNDKVF KAGLRRKMRK       360
     AAMDRNYLAS VLAGSGLS                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page