(data stored in ACNUC10821 zone)

EMBL: AP010958.PE663

AP010958.PE663       Location/Qualifiers
FT   CDS             725882..727759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ECO103_0663"
FT                   /product="rhomboid family protein"
FT                   /note="similar to c0741 [Escherichia coli CFT073], 92.0%
FT                   identity in 625 aa overlap, GeneHacker: Min.length=60,
FT                   Min.score =15, overlap=0.4"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0663"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29526"
FT                   /db_xref="GOA:C8U318"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR011964"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:C8U318"
FT                   /protein_id="BAI29526.1"
FT                   /translation="MSASSVKPLNVQLPAITLILFALCIGIFCYLAQWMSYEEVDQSAL
FT                   IHLGANVAPLTLSGEPWRLLSSIFLHSSVSHLLMNMFAFLVVGGVAEQILGKWRLLITW
FT                   LFSGVFGGLISACYALRESEQIVISVGASGAILGIAGAAIATQFASGTGTYHKNQRRVF
FT                   PLLGMVALTLLYGARQTGIDNACHIGGLIAGGALGWLSARLSGQNRLVTEGGIIVAGSL
FT                   LLTGAIWLAQQQMDESVLQVRQSLREAFYPQEIEQERRQKKQQLAEERNALRETLSAPV
FT                   SREQANGDLLAEIADIHDMAISRDGNTLYAAIEDTNSIVVFDLGQKKILHTFTAPIAKE
FT                   KSVKHCGGCKDQGVRSLALSPDEKLIYATSFEANALSVINVATGEIIQSITTGAHPDSL
FT                   ILSRDGTKAWVMNRTSNSVSAIDLVAYQHVADIPLEKYDGTGTSGKPGAWVMALSPDER
FT                   TLLVPGEGRGNIVRINTITHQKEDFPAGDARGTISAMRFRPENGEVIFADSQGISRISI
FT                   GDQQTSIMTQWCSRSVYSVEGISPDGQYLALVSYGLQGYVILLNINAGQIIGVYPASYV
FT                   NHLRFSADGRKIFVMAKNGLIQMDRTRSLDPQAIIRHPQYGNVACIPEP"
     MSASSVKPLN VQLPAITLIL FALCIGIFCY LAQWMSYEEV DQSALIHLGA NVAPLTLSGE        60
     PWRLLSSIFL HSSVSHLLMN MFAFLVVGGV AEQILGKWRL LITWLFSGVF GGLISACYAL       120
     RESEQIVISV GASGAILGIA GAAIATQFAS GTGTYHKNQR RVFPLLGMVA LTLLYGARQT       180
     GIDNACHIGG LIAGGALGWL SARLSGQNRL VTEGGIIVAG SLLLTGAIWL AQQQMDESVL       240
     QVRQSLREAF YPQEIEQERR QKKQQLAEER NALRETLSAP VSREQANGDL LAEIADIHDM       300
     AISRDGNTLY AAIEDTNSIV VFDLGQKKIL HTFTAPIAKE KSVKHCGGCK DQGVRSLALS       360
     PDEKLIYATS FEANALSVIN VATGEIIQSI TTGAHPDSLI LSRDGTKAWV MNRTSNSVSA       420
     IDLVAYQHVA DIPLEKYDGT GTSGKPGAWV MALSPDERTL LVPGEGRGNI VRINTITHQK       480
     EDFPAGDARG TISAMRFRPE NGEVIFADSQ GISRISIGDQ QTSIMTQWCS RSVYSVEGIS       540
     PDGQYLALVS YGLQGYVILL NINAGQIIGV YPASYVNHLR FSADGRKIFV MAKNGLIQMD       600
     RTRSLDPQAI IRHPQYGNVA CIPEP                                             625
//

If you have problems or comments...

PBIL Back to PBIL home page