(data stored in ACNUC10821 zone)

EMBL: AP010958.PHOR

AP010958.PHOR        Location/Qualifiers
FT   CDS             424205..425500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoR"
FT                   /locus_tag="ECO103_0374"
FT                   /product="sensory histidine kinase PhoR in two-component
FT                   regulatory system with PhoB"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0374"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29242"
FT                   /db_xref="GOA:C8U284"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR014310"
FT                   /db_xref="InterPro:IPR021766"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C8U284"
FT                   /protein_id="BAI29242.1"
FT                   /translation="MLERLSWKRLVLELLLCCFPAFILGAFLGYLPWFLLASVTGLLIW
FT                   HFWNLLRLSWWLWVDRSMTPPPGRGSWEPLLYGLHQMQLRNKKRRRELGNLIKRFRSGA
FT                   ESLPDAVVLTTEEGGIFWCNGLAQQILGLRWPEDNGQNILNLLRYPEFTQYLKTRDFSR
FT                   PLNLVLNTGRHLEIRVMPYTHKQLLMVARDVTQMHQLEGARRNFFANVSHELRTPLTVL
FT                   QGYLEMMDEQPLEGAVREKALHTMREQTQRMEGLVKQLLTLSKIEAAPTHLLNEKVDVP
FT                   MMLRVVEREAQTLSQKKQTFTFEIDNGLKVSGNEDQLRSAISNLVYNAVNHTPEGTHIT
FT                   VRWQRVPHGAEFSVEDNGPGIAPEHIPRLTERFYRVDKARSRQTGGSGLGLAIVKHAVN
FT                   HHESRLNIESTVGKGTRFSFVIPERLIAKNSD"
     MLERLSWKRL VLELLLCCFP AFILGAFLGY LPWFLLASVT GLLIWHFWNL LRLSWWLWVD        60
     RSMTPPPGRG SWEPLLYGLH QMQLRNKKRR RELGNLIKRF RSGAESLPDA VVLTTEEGGI       120
     FWCNGLAQQI LGLRWPEDNG QNILNLLRYP EFTQYLKTRD FSRPLNLVLN TGRHLEIRVM       180
     PYTHKQLLMV ARDVTQMHQL EGARRNFFAN VSHELRTPLT VLQGYLEMMD EQPLEGAVRE       240
     KALHTMREQT QRMEGLVKQL LTLSKIEAAP THLLNEKVDV PMMLRVVERE AQTLSQKKQT       300
     FTFEIDNGLK VSGNEDQLRS AISNLVYNAV NHTPEGTHIT VRWQRVPHGA EFSVEDNGPG       360
     IAPEHIPRLT ERFYRVDKAR SRQTGGSGLG LAIVKHAVNH HESRLNIEST VGKGTRFSFV       420
     IPERLIAKNS D                                                            431
//

If you have problems or comments...

PBIL Back to PBIL home page