(data stored in ACNUC10821 zone)

EMBL: AP010958.PPDD/HCPA

AP010958.PPDD/HCPA   Location/Qualifiers
FT   CDS             complement(118710..119150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppdD/hcpA"
FT                   /locus_tag="ECO103_0108"
FT                   /product="predicted major pilin subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0108"
FT                   /db_xref="EnsemblGenomes-Tr:BAI28986"
FT                   /db_xref="GOA:C8U1H8"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:C8U1H8"
FT                   /protein_id="BAI28986.1"
FT                   /translation="MDKQRGFTLIELMVVIGIIAILSAIGIPAYQNYLRKAALTDMLQT
FT                   FVPYRTAVELCALEHGGLDTCDGGSNGIPSPTTTHYVSAMSVAKGVVSLTGQESLNGLS
FT                   VVMTPGWDNANGVTGWTRNCNIQSDSALHQACEDVFRFDDAN"
     MDKQRGFTLI ELMVVIGIIA ILSAIGIPAY QNYLRKAALT DMLQTFVPYR TAVELCALEH        60
     GGLDTCDGGS NGIPSPTTTH YVSAMSVAKG VVSLTGQESL NGLSVVMTPG WDNANGVTGW       120
     TRNCNIQSDS ALHQACEDVF RFDDAN                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page