(data stored in ACNUC10821 zone)

EMBL: AP010958.PRIC

AP010958.PRIC        Location/Qualifiers
FT   CDS             complement(498874..499401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priC"
FT                   /locus_tag="ECO103_0443"
FT                   /product="primosomal replication protein N"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0443"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29311"
FT                   /db_xref="InterPro:IPR010890"
FT                   /db_xref="InterPro:IPR038338"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2F3"
FT                   /protein_id="BAI29311.1"
FT                   /translation="MKTALLLEKLEGQLATLRQRCAPVAQFATLSARFDRHLFQTRATT
FT                   LQACLDEAGDNLAALRHAVEQQQLPQVAWLAEHLAAQLEAIAREASAWSLREWDSAPPK
FT                   IARWQRKRIQHQDFERRLREMVAERRARLARVTDLVEQQTLHREVEAYEARLARCRHAL
FT                   EKIENRLARLTR"
     MKTALLLEKL EGQLATLRQR CAPVAQFATL SARFDRHLFQ TRATTLQACL DEAGDNLAAL        60
     RHAVEQQQLP QVAWLAEHLA AQLEAIAREA SAWSLREWDS APPKIARWQR KRIQHQDFER       120
     RLREMVAERR ARLARVTDLV EQQTLHREVE AYEARLARCR HALEKIENRL ARLTR            175
//

If you have problems or comments...

PBIL Back to PBIL home page