(data stored in ACNUC10821 zone)

EMBL: AP010958.RECR

AP010958.RECR        Location/Qualifiers
FT   CDS             502994..503599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="ECO103_0448"
FT                   /product="gap repair protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0448"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29316"
FT                   /db_xref="GOA:C8U2F8"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2F8"
FT                   /protein_id="BAI29316.1"
FT                   /translation="MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQ
FT                   ALTRAMSEIGHCADCRTFTEQEVCNICSNPRRQENGQICVVESPADIYAIEQTGQFSGR
FT                   YFVLMGHLSPLDGIGPDDIGLDRLEQRLAEEKITEVILATNPTVEGEATANYIAELCAQ
FT                   YDVEASRIAHGVPVGGELEMVDGTTLSHSLAGRHKIRF"
     MQTSPLLTQL MEALRCLPGV GPKSAQRMAF TLLQRDRSGG MRLAQALTRA MSEIGHCADC        60
     RTFTEQEVCN ICSNPRRQEN GQICVVESPA DIYAIEQTGQ FSGRYFVLMG HLSPLDGIGP       120
     DDIGLDRLEQ RLAEEKITEV ILATNPTVEG EATANYIAEL CAQYDVEASR IAHGVPVGGE       180
     LEMVDGTTLS HSLAGRHKIR F                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page