(data stored in ACNUC10821 zone)

EMBL: AP010958.SFMD

AP010958.SFMD        Location/Qualifiers
FT   CDS             566843..569305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfmD"
FT                   /locus_tag="ECO103_0504"
FT                   /product="predicted outer membrane export usher protein
FT                   SfmD"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0504"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29371"
FT                   /db_xref="GOA:C8U2L3"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR018030"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2L3"
FT                   /protein_id="BAI29371.1"
FT                   /translation="MKIPTTTDIPQRYTWCLAGICYSSLAILLSFLSYAESYFNPAFLL
FT                   ENGTSVADLSRFERGNHQPAGVYRVDLWRNDEFIGSQDIVFESTTENTGDKSGGLMPCF
FT                   NQVLLERIGLNSSAFPELAQQQNNKCINLLKAVPDATINFDFAAMRLNITIPQITLLSS
FT                   AHGYIPPEEWDEGIPALLLNYNFTGNRGNGNDSYFFSELSGINIGPWRLRNNGSWNYFR
FT                   GNGYHSEQWNNIGTWVQRAIIPLKSELVMGDGNTGSDIFDGVGFRGVRLYSSDNMYPDS
FT                   QQGFAPTVRGIARTAAQLTIRQNGFIIYQSYVSPGAFEITDLHPTSSNGDLDVTIDERD
FT                   GNQQNYTIPYSTVPILQREGRFKFDLTAGDFRSGNSQQSSPFFFQGTALGGLPQEFTAY
FT                   GGTQLSANYTAFLLGLGRNLGNWGAVSLDVTHARSQLADDSRHEGDSIRFLYAKSMNTF
FT                   GTNFQLMGYRYSTQGFYTLDDVAYRRMEGYEYDYDYDGEHRDEPIIVNYHNLRFSRKDR
FT                   LQLNISQSLNDFGSLYISGTHQKYWNTSDSDTWYQVGYTSSWVGISYSLSFSWNESVGI
FT                   PDNERIVGLNVSVPFNVLTKRRYTRENALDRAYASFNANRNSNGQNSWLAGVGGTLLEG
FT                   HNLSYHVSQGDTSNNGYTGSATANWQAAYATLGVGYNYDRDQHDVNWQLSGGVVGHENG
FT                   ITLSQPLGDTNVLIKAPGAGGVRIENQTGILTDWRGYAVMPYATVYRYNRIALDTNTMG
FT                   NSIDVEKNISSVVPTQGALVRANFDTRIGVRALITVTQGGKPVPFGSLVRENSIGITSM
FT                   WVMTGKFI"
     MKIPTTTDIP QRYTWCLAGI CYSSLAILLS FLSYAESYFN PAFLLENGTS VADLSRFERG        60
     NHQPAGVYRV DLWRNDEFIG SQDIVFESTT ENTGDKSGGL MPCFNQVLLE RIGLNSSAFP       120
     ELAQQQNNKC INLLKAVPDA TINFDFAAMR LNITIPQITL LSSAHGYIPP EEWDEGIPAL       180
     LLNYNFTGNR GNGNDSYFFS ELSGINIGPW RLRNNGSWNY FRGNGYHSEQ WNNIGTWVQR       240
     AIIPLKSELV MGDGNTGSDI FDGVGFRGVR LYSSDNMYPD SQQGFAPTVR GIARTAAQLT       300
     IRQNGFIIYQ SYVSPGAFEI TDLHPTSSNG DLDVTIDERD GNQQNYTIPY STVPILQREG       360
     RFKFDLTAGD FRSGNSQQSS PFFFQGTALG GLPQEFTAYG GTQLSANYTA FLLGLGRNLG       420
     NWGAVSLDVT HARSQLADDS RHEGDSIRFL YAKSMNTFGT NFQLMGYRYS TQGFYTLDDV       480
     AYRRMEGYEY DYDYDGEHRD EPIIVNYHNL RFSRKDRLQL NISQSLNDFG SLYISGTHQK       540
     YWNTSDSDTW YQVGYTSSWV GISYSLSFSW NESVGIPDNE RIVGLNVSVP FNVLTKRRYT       600
     RENALDRAYA SFNANRNSNG QNSWLAGVGG TLLEGHNLSY HVSQGDTSNN GYTGSATANW       660
     QAAYATLGVG YNYDRDQHDV NWQLSGGVVG HENGITLSQP LGDTNVLIKA PGAGGVRIEN       720
     QTGILTDWRG YAVMPYATVY RYNRIALDTN TMGNSIDVEK NISSVVPTQG ALVRANFDTR       780
     IGVRALITVT QGGKPVPFGS LVRENSIGIT SMWVMTGKFI                             820
//

If you have problems or comments...

PBIL Back to PBIL home page