(data stored in ACNUC10821 zone)

EMBL: AP010958.SFMF

AP010958.SFMF        Location/Qualifiers
FT   CDS             570482..570997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfmF"
FT                   /locus_tag="ECO103_0506"
FT                   /product="predicted fimbrial-like adhesin protein SfmF"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0506"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29373"
FT                   /db_xref="GOA:C8U2L5"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2L5"
FT                   /protein_id="BAI29373.1"
FT                   /translation="MRRALFSCFCGLLWISSGWAADPLGTININLHGNVVDFSCTVNTA
FT                   DIDKTVDLGRWPTTQLLNAGDTTALVPFSLRLEGCPPGSVAILFTGTPASDTNLLALDD
FT                   PAMAQTIAIELRNSDRSRLALGAASPTEEVDANGNVTLNFFANYRALASGVRPGVAKAD
FT                   AIFMINYN"
     MRRALFSCFC GLLWISSGWA ADPLGTININ LHGNVVDFSC TVNTADIDKT VDLGRWPTTQ        60
     LLNAGDTTAL VPFSLRLEGC PPGSVAILFT GTPASDTNLL ALDDPAMAQT IAIELRNSDR       120
     SRLALGAASP TEEVDANGNV TLNFFANYRA LASGVRPGVA KADAIFMINY N                171
//

If you have problems or comments...

PBIL Back to PBIL home page