(data stored in SCRATCH zone)

EMBL: AP010958.TAUA

AP010958.TAUA        Location/Qualifiers
FT   CDS             392842..393804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tauA"
FT                   /locus_tag="ECO103_0344"
FT                   /product="taurine transporter subunit TauA"
FT                   /note="periplasmic-binding component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0344"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29213"
FT                   /db_xref="GOA:C8U255"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR010068"
FT                   /db_xref="UniProtKB/TrEMBL:C8U255"
FT                   /protein_id="BAI29213.1"
FT                   /translation="MAISSRNTLLAALAFIAFQAQAVNVTVAYQTSAEPAKVAQADNTF
FT                   AKESGASVDWRKFDSGASIVRALASGDVQIGNLGSSPLAVAASQQVPIEVFLLASKLGN
FT                   SEALVVKKTISKPEDLIGKRIAVPFISTTHYSLLAALKHWGIKPGQVEIVNLQPPAIIA
FT                   AWQRGDIDGAYVWAPAVNALEKDGKVLTDSEQVGQWGAPTLDVWVVRKDYAEKHPEVVK
FT                   AFAKSAIDAQQPYIANPDVWLKQPENISKLARLSGVPEGDVPGLVKGNTYLTPQQQTAE
FT                   LTGPVNKAIIDTAQFLKEQGKVPAVANDYSQYVTSRFVQ"
     MAISSRNTLL AALAFIAFQA QAVNVTVAYQ TSAEPAKVAQ ADNTFAKESG ASVDWRKFDS        60
     GASIVRALAS GDVQIGNLGS SPLAVAASQQ VPIEVFLLAS KLGNSEALVV KKTISKPEDL       120
     IGKRIAVPFI STTHYSLLAA LKHWGIKPGQ VEIVNLQPPA IIAAWQRGDI DGAYVWAPAV       180
     NALEKDGKVL TDSEQVGQWG APTLDVWVVR KDYAEKHPEV VKAFAKSAID AQQPYIANPD       240
     VWLKQPENIS KLARLSGVPE GDVPGLVKGN TYLTPQQQTA ELTGPVNKAI IDTAQFLKEQ       300
     GKVPAVANDY SQYVTSRFVQ                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page