(data stored in SCRATCH zone)

EMBL: AP010958.TBPA

AP010958.TBPA        Location/Qualifiers
FT   CDS             complement(76214..77197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tbpA"
FT                   /locus_tag="ECO103_0069"
FT                   /product="thiamin transporter subunit TbpA"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0069"
FT                   /db_xref="EnsemblGenomes-Tr:BAI28947"
FT                   /db_xref="GOA:C8U1D9"
FT                   /db_xref="InterPro:IPR005948"
FT                   /db_xref="InterPro:IPR005967"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:C8U1D9"
FT                   /protein_id="BAI28947.1"
FT                   /translation="MLKKCLPLLLLCTAPVFAKPVLTVYTYDSFAADWGPGPKIKKAFE
FT                   ADCNCELKLVALEDGVSLLNRLRMEGKNSKADVVLGLDNNLLDAASKTGLFAKSGVAAD
FT                   AVNVPGGWNNDTFVPFDYGYFAFVYDKNKLKNPPQSLKELVESDQNWRVIYQDPRTSTP
FT                   GLGLLLWMQKVYGDDAPQAWQKLAKKTVTVTKGWSEAYGLFLKGESDLVLSYTTSPAYH
FT                   ILEEKKDNYAAANFSEGHYLQVEVAARTAASKQPELAQKFLQFMVSPAFQNAIPTGNWM
FT                   YPVANVTLPAGFEQLTKPATTLEFTPAEVAAQRQAWISEWQRAVSR"
     MLKKCLPLLL LCTAPVFAKP VLTVYTYDSF AADWGPGPKI KKAFEADCNC ELKLVALEDG        60
     VSLLNRLRME GKNSKADVVL GLDNNLLDAA SKTGLFAKSG VAADAVNVPG GWNNDTFVPF       120
     DYGYFAFVYD KNKLKNPPQS LKELVESDQN WRVIYQDPRT STPGLGLLLW MQKVYGDDAP       180
     QAWQKLAKKT VTVTKGWSEA YGLFLKGESD LVLSYTTSPA YHILEEKKDN YAAANFSEGH       240
     YLQVEVAART AASKQPELAQ KFLQFMVSPA FQNAIPTGNW MYPVANVTLP AGFEQLTKPA       300
     TTLEFTPAEV AAQRQAWISE WQRAVSR                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page