(data stored in ACNUC10821 zone)

EMBL: AP010958.YAAI

AP010958.YAAI        Location/Qualifiers
FT   CDS             complement(12660..13064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaI"
FT                   /locus_tag="ECO103_0013"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0013"
FT                   /db_xref="EnsemblGenomes-Tr:BAI28896"
FT                   /db_xref="InterPro:IPR020240"
FT                   /db_xref="UniProtKB/TrEMBL:C8U188"
FT                   /protein_id="BAI28896.1"
FT                   /translation="MKSVFTISASLAISLMLCCTAQANDHKILGVIAMPRNETNDLALK
FT                   LPVCRIVKRIQLSADHGDLQLSGASVYFKAARSASQSLNIPSEIKEGQTTDWININSDN
FT                   DNKRCVSKITFSGHTVNSSDMATLKIIGDD"
     MKSVFTISAS LAISLMLCCT AQANDHKILG VIAMPRNETN DLALKLPVCR IVKRIQLSAD        60
     HGDLQLSGAS VYFKAARSAS QSLNIPSEIK EGQTTDWINI NSDNDNKRCV SKITFSGHTV       120
     NSSDMATLKI IGDD                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page