(data stored in ACNUC10821 zone)

EMBL: AP010958.YAAW

AP010958.YAAW        Location/Qualifiers
FT   CDS             complement(11921..12634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaaW"
FT                   /locus_tag="ECO103_0012"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0012"
FT                   /db_xref="EnsemblGenomes-Tr:BAI28895"
FT                   /db_xref="InterPro:IPR021150"
FT                   /db_xref="InterPro:IPR025217"
FT                   /db_xref="UniProtKB/TrEMBL:C8U187"
FT                   /protein_id="BAI28895.1"
FT                   /translation="MNVNYLNDSDLDFLQHCSEEQLANFARLLTHNEKGKTRLSSVLMR
FT                   NELFKSMEGHPEQHRRNWQLIAGELQHFGGDSIANKLRGHGKLYRAILLDVSKRLKLKA
FT                   DKEMSTFEIEQQLLEQFLRNTWKNMDEEHKQEFLHAIDARVNELEELLPLLMKDKLLAK
FT                   GVSHLLSSQLTRILRTHAAMSVLGHGLLRGAGLGGPVGAALNGVKAVSGSAYRVTIPAV
FT                   LQIACLRRMVSATQV"
     MNVNYLNDSD LDFLQHCSEE QLANFARLLT HNEKGKTRLS SVLMRNELFK SMEGHPEQHR        60
     RNWQLIAGEL QHFGGDSIAN KLRGHGKLYR AILLDVSKRL KLKADKEMST FEIEQQLLEQ       120
     FLRNTWKNMD EEHKQEFLHA IDARVNELEE LLPLLMKDKL LAKGVSHLLS SQLTRILRTH       180
     AAMSVLGHGL LRGAGLGGPV GAALNGVKAV SGSAYRVTIP AVLQIACLRR MVSATQV          237
//

If you have problems or comments...

PBIL Back to PBIL home page