(data stored in SCRATCH zone)

EMBL: AP010958.YACH

AP010958.YACH        Location/Qualifiers
FT   CDS             complement(131008..132765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yacH"
FT                   /locus_tag="ECO103_0117"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0117"
FT                   /db_xref="EnsemblGenomes-Tr:BAI28995"
FT                   /db_xref="InterPro:IPR021728"
FT                   /db_xref="UniProtKB/TrEMBL:C8U1I7"
FT                   /protein_id="BAI28995.1"
FT                   /translation="MKMTLPFKPHVLALICSAGLCAASTGLYIKSRTVEAPVEPQSTQQ
FT                   TAPDITAVTLPATVSAPPVTPAVVKSAFSTAQIDQWVAPVALYPDSLLSQVLMASTYPA
FT                   NVAQAVQWSHDNPLKQGDAAIQAVSDQPWDASVKSLVAFPQLMALMGENPQWVQNLGDA
FT                   FLAQPQDVMDSVQRLRQLAQQTGSLKSSTEQKVITTTKKAVPVKQTVTAPVIPSNTVLT
FT                   ASPVITEPATTVISIEPANPDVVYIPNYNPTVVYGNWANTAYPPVYLPPPAGEPFIDSF
FT                   VRGFGYSMGVATTYALFSSIDWDDDDHDHHHHDDDDYHHHDGGHRDGNGWQHNGDNINI
FT                   DVNNFNRITGEHLTDKNMAWRHNPNYRNGVPYHDQDMAKRFHQTDVNGGMSATQLPAPT
FT                   RDSQRQAAASQFQQRTHAAPVITRDTQRQAAAQRFNEAENYGSYDDFRDFSRRQPLTQQ
FT                   QKDAARQRYQSASPEQRQAVREKMQTNPQIQQRRDAARERIQSASPEQRQVFKEKVQQR
FT                   PLNQQQRDNARQRVQSASPEQRQVFREKVQESRPQRLNDSNHTVRLNNEQRSAVRERLS
FT                   ERGARRQER"
     MKMTLPFKPH VLALICSAGL CAASTGLYIK SRTVEAPVEP QSTQQTAPDI TAVTLPATVS        60
     APPVTPAVVK SAFSTAQIDQ WVAPVALYPD SLLSQVLMAS TYPANVAQAV QWSHDNPLKQ       120
     GDAAIQAVSD QPWDASVKSL VAFPQLMALM GENPQWVQNL GDAFLAQPQD VMDSVQRLRQ       180
     LAQQTGSLKS STEQKVITTT KKAVPVKQTV TAPVIPSNTV LTASPVITEP ATTVISIEPA       240
     NPDVVYIPNY NPTVVYGNWA NTAYPPVYLP PPAGEPFIDS FVRGFGYSMG VATTYALFSS       300
     IDWDDDDHDH HHHDDDDYHH HDGGHRDGNG WQHNGDNINI DVNNFNRITG EHLTDKNMAW       360
     RHNPNYRNGV PYHDQDMAKR FHQTDVNGGM SATQLPAPTR DSQRQAAASQ FQQRTHAAPV       420
     ITRDTQRQAA AQRFNEAENY GSYDDFRDFS RRQPLTQQQK DAARQRYQSA SPEQRQAVRE       480
     KMQTNPQIQQ RRDAARERIQ SASPEQRQVF KEKVQQRPLN QQQRDNARQR VQSASPEQRQ       540
     VFREKVQESR PQRLNDSNHT VRLNNEQRSA VRERLSERGA RRQER                       585
//

If you have problems or comments...

PBIL Back to PBIL home page