(data stored in SCRATCH zone)

EMBL: AP010958.YADI

AP010958.YADI        Location/Qualifiers
FT   CDS             145927..146367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yadI"
FT                   /locus_tag="ECO103_0129"
FT                   /product="predicted PTS Enzyme IIA"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0129"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29007"
FT                   /db_xref="GOA:C8U1J9"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:C8U1J9"
FT                   /protein_id="BAI29007.1"
FT                   /translation="MLGWVITCHDDRAQEILDALEKKHGALLQCRAVNFWRGLSSNMLS
FT                   RMMCDALHEADSGEGVIFLTDIAGAPPYRVASLLSHKHSRCEVISGVTLPLIEQMMACR
FT                   ETMTSSEFRERIVELGGPEVSSLWHQQQKNPPFVLKHNLYEY"
     MLGWVITCHD DRAQEILDAL EKKHGALLQC RAVNFWRGLS SNMLSRMMCD ALHEADSGEG        60
     VIFLTDIAGA PPYRVASLLS HKHSRCEVIS GVTLPLIEQM MACRETMTSS EFRERIVELG       120
     GPEVSSLWHQ QQKNPPFVLK HNLYEY                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page