(data stored in ACNUC10821 zone)

EMBL: AP010958.YAEJ

AP010958.YAEJ        Location/Qualifiers
FT   CDS             215392..215814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaeJ"
FT                   /locus_tag="ECO103_0190"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0190"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29068"
FT                   /db_xref="GOA:C8U1R0"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:C8U1R0"
FT                   /protein_id="BAI29068.1"
FT                   /translation="MIVISRHVAIPDGELEITAIRAQGAGGQHVNKTSTAIHLRFDIRA
FT                   SSLPEYYKERLLAASHHLISSDGVIVIKAQEYRSQELNREAALARLVAVIKDLTTEQKA
FT                   RRPTRPTRASKKRRLASKAQKSSVKAMRGKVRSGRE"
     MIVISRHVAI PDGELEITAI RAQGAGGQHV NKTSTAIHLR FDIRASSLPE YYKERLLAAS        60
     HHLISSDGVI VIKAQEYRSQ ELNREAALAR LVAVIKDLTT EQKARRPTRP TRASKKRRLA       120
     SKAQKSSVKA MRGKVRSGRE                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page