(data stored in ACNUC10821 zone)

EMBL: AP010958.YAHD

AP010958.YAHD        Location/Qualifiers
FT   CDS             339268..339873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahD"
FT                   /locus_tag="ECO103_0296"
FT                   /product="predicted transcriptional regulator"
FT                   /note="contains ankyrin domain"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0296"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29166"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C8U208"
FT                   /protein_id="BAI29166.1"
FT                   /translation="MSIKNLPADYLLAAQQGDIDKVKTCLALGVDINTCDRQGKTAITL
FT                   ASLYQQYACVQALIDAGADINKQDHTCLNPFLISCLNDDLTLLRIILPAKPDLNCVTRF
FT                   GGVGLTPACEKGHLSIVKELLAHTEINVNQTNHVGWTPLLEAIVLNDGGIKQQAIVQLL
FT                   LEHGASPHLTDKYGKTPLELARERGFEEIAQLLIAAGA"
     MSIKNLPADY LLAAQQGDID KVKTCLALGV DINTCDRQGK TAITLASLYQ QYACVQALID        60
     AGADINKQDH TCLNPFLISC LNDDLTLLRI ILPAKPDLNC VTRFGGVGLT PACEKGHLSI       120
     VKELLAHTEI NVNQTNHVGW TPLLEAIVLN DGGIKQQAIV QLLLEHGASP HLTDKYGKTP       180
     LELARERGFE EIAQLLIAAG A                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page