(data stored in SCRATCH zone)

EMBL: AP010958.YAHE

AP010958.YAHE        Location/Qualifiers
FT   CDS             339913..340776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahE"
FT                   /locus_tag="ECO103_0297"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0297"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29167"
FT                   /db_xref="InterPro:IPR021530"
FT                   /db_xref="UniProtKB/TrEMBL:C8U209"
FT                   /protein_id="BAI29167.1"
FT                   /translation="MWALTADADFLAQRGQGQVEQVFARAVNIALPARQQLLTLLCEEY
FT                   DNAPNSCRLALTHFDDLFRHGDKVQFDDQGITVGQHLHIEMSRCRRWLSPTLQMTAVNF
FT                   HLIAWQQWHDIIHQHLGENETLFNYRGDNPFYQALNKELHIKRRAVIQAVNEKQNIAAA
FT                   VASMIGLGIGLTPSADDYLTGLALILFIPGHPSEKYKEEFYLGMQRGRNNTTLLSAITL
FT                   EAALQQRCRENIHRFIHNIIYDIPGNATQAIEKIKHIGSSSGCDMLYGMADGCALSQTY
FT                   GGNYVS"
     MWALTADADF LAQRGQGQVE QVFARAVNIA LPARQQLLTL LCEEYDNAPN SCRLALTHFD        60
     DLFRHGDKVQ FDDQGITVGQ HLHIEMSRCR RWLSPTLQMT AVNFHLIAWQ QWHDIIHQHL       120
     GENETLFNYR GDNPFYQALN KELHIKRRAV IQAVNEKQNI AAAVASMIGL GIGLTPSADD       180
     YLTGLALILF IPGHPSEKYK EEFYLGMQRG RNNTTLLSAI TLEAALQQRC RENIHRFIHN       240
     IIYDIPGNAT QAIEKIKHIG SSSGCDMLYG MADGCALSQT YGGNYVS                     287
//

If you have problems or comments...

PBIL Back to PBIL home page