(data stored in ACNUC10821 zone)

EMBL: AP010958.YAHI

AP010958.YAHI        Location/Qualifiers
FT   CDS             343874..344824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahI"
FT                   /locus_tag="ECO103_0300"
FT                   /product="predicted carbamate kinase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0300"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29170"
FT                   /db_xref="GOA:C8U212"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:C8U212"
FT                   /protein_id="BAI29170.1"
FT                   /translation="MKELVVVAIGGNSIIKDNASQSIEHQAEAVKAVADTVLEMLASDY
FT                   DIVLTHGNGPQVGLDLRRAEIAHEREGLPLTPLANCVADTQGGIGYLIQQALNNRLARH
FT                   GEKKAVTVVTQVEVDKNDPGFAHPTKPIGAFFSESQRDKLQKANPDWCFVEDAGRGYRR
FT                   VVASPEPKRIVEAPAIKALIQQGFVVIGAGGGGIPVVRTEAGDYQSVDAVIDKDLSTAL
FT                   LAREIHADILVITTGVEKVCIHFGKPQQQALDRVDIATMTRYMQEGHFPPGSMLPKIIA
FT                   SLTFLEQGGKEVIITTPECLPAALRGETGTHIIKT"
     MKELVVVAIG GNSIIKDNAS QSIEHQAEAV KAVADTVLEM LASDYDIVLT HGNGPQVGLD        60
     LRRAEIAHER EGLPLTPLAN CVADTQGGIG YLIQQALNNR LARHGEKKAV TVVTQVEVDK       120
     NDPGFAHPTK PIGAFFSESQ RDKLQKANPD WCFVEDAGRG YRRVVASPEP KRIVEAPAIK       180
     ALIQQGFVVI GAGGGGIPVV RTEAGDYQSV DAVIDKDLST ALLAREIHAD ILVITTGVEK       240
     VCIHFGKPQQ QALDRVDIAT MTRYMQEGHF PPGSMLPKII ASLTFLEQGG KEVIITTPEC       300
     LPAALRGETG THIIKT                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page