(data stored in ACNUC10821 zone)

EMBL: AP010958.YAHL

AP010958.YAHL        Location/Qualifiers
FT   CDS             352992..353807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahL"
FT                   /locus_tag="ECO103_0308"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0308"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29178"
FT                   /db_xref="UniProtKB/TrEMBL:C8U220"
FT                   /protein_id="BAI29178.1"
FT                   /translation="MISLKAPHNNLMPYTQQSILNTVKNNQLPEDIKSSLVSCVDIFKV
FT                   LIKQYYDYPYDCRDDLVDDDKLIHLMAAVRDCEWSDDNALTINVQFNDFPGFYDWMDYP
FT                   DHPVKFVFRILENQKGTVWVYDQDDAFLDIKANVQAGRFTGLKKLVQFIDSVRTDCKCI
FT                   LLEHHMPLLRIFPKGKECMHVEKWLREMSSIPETDAPIKQALAHGLLLHLKNIYPVFPE
FT                   SLVMLLLSVLDVKTYRDDARLNQWISNRVQELGDRYYPVNKHVKIRYTL"
     MISLKAPHNN LMPYTQQSIL NTVKNNQLPE DIKSSLVSCV DIFKVLIKQY YDYPYDCRDD        60
     LVDDDKLIHL MAAVRDCEWS DDNALTINVQ FNDFPGFYDW MDYPDHPVKF VFRILENQKG       120
     TVWVYDQDDA FLDIKANVQA GRFTGLKKLV QFIDSVRTDC KCILLEHHMP LLRIFPKGKE       180
     CMHVEKWLRE MSSIPETDAP IKQALAHGLL LHLKNIYPVF PESLVMLLLS VLDVKTYRDD       240
     ARLNQWISNR VQELGDRYYP VNKHVKIRYT L                                      271
//

If you have problems or comments...

PBIL Back to PBIL home page