(data stored in ACNUC10821 zone)

EMBL: AP010958.YAIE

AP010958.YAIE        Location/Qualifiers
FT   CDS             414597..414881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiE"
FT                   /locus_tag="ECO103_0366"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0366"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29235"
FT                   /db_xref="GOA:C8U277"
FT                   /db_xref="InterPro:IPR009664"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C8U277"
FT                   /protein_id="BAI29235.1"
FT                   /translation="MLQSNEYFSGKVKSIGFSSSSTGRASVGVMVEGEYTFSTAEPEEM
FT                   TVISGALNVLLPDATDWQVYEAGSVFNVPGHSEFHLQVAEPTSYLCRYL"
     MLQSNEYFSG KVKSIGFSSS STGRASVGVM VEGEYTFSTA EPEEMTVISG ALNVLLPDAT        60
     DWQVYEAGSV FNVPGHSEFH LQVAEPTSYL CRYL                                    94
//

If you have problems or comments...

PBIL Back to PBIL home page