(data stored in ACNUC10821 zone)

EMBL: AP010958.YAIY

AP010958.YAIY        Location/Qualifiers
FT   CDS             complement(405445..405753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yaiY"
FT                   /locus_tag="ECO103_0354"
FT                   /product="predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0354"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29223"
FT                   /db_xref="GOA:C8U265"
FT                   /db_xref="InterPro:IPR020513"
FT                   /db_xref="UniProtKB/TrEMBL:C8U265"
FT                   /protein_id="BAI29223.1"
FT                   /translation="MADFTLSKSLFSGKYRNASSTPGNIAYALFVLFCFWAGAQLLNLL
FT                   VHAPGVYERLMQVQETGRPRVEIGLGVGTIFGLIPFLVGCLIFAVVALWLHWRHRRQ"
     MADFTLSKSL FSGKYRNASS TPGNIAYALF VLFCFWAGAQ LLNLLVHAPG VYERLMQVQE        60
     TGRPRVEIGL GVGTIFGLIP FLVGCLIFAV VALWLHWRHR RQ                          102
//

If you have problems or comments...

PBIL Back to PBIL home page