(data stored in ACNUC10821 zone)

EMBL: AP010958.YAJC

AP010958.YAJC        Location/Qualifiers
FT   CDS             433603..433935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajC"
FT                   /locus_tag="ECO103_0381"
FT                   /product="SecYEG protein translocase auxillary subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0381"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29249"
FT                   /db_xref="GOA:C8U291"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:C8U291"
FT                   /protein_id="BAI29249.1"
FT                   /translation="MSFFISDAVAATGAPAQGSPMSLILMLVVFGLIFYFMILRPQQKR
FT                   TKEHKKLMDSIAKGDEVLTNGGLVGRVTKVAENGYIAIALNDTTEVVIKRDFVAAVLPK
FT                   GTMKAL"
     MSFFISDAVA ATGAPAQGSP MSLILMLVVF GLIFYFMILR PQQKRTKEHK KLMDSIAKGD        60
     EVLTNGGLVG RVTKVAENGY IAIALNDTTE VVIKRDFVAA VLPKGTMKAL                  110
//

If you have problems or comments...

PBIL Back to PBIL home page