(data stored in SCRATCH zone)

EMBL: AP010958.YAJD

AP010958.YAJD        Location/Qualifiers
FT   CDS             436921..437268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajD"
FT                   /locus_tag="ECO103_0384"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0384"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29252"
FT                   /db_xref="GOA:C8U294"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:C8U294"
FT                   /protein_id="BAI29252.1"
FT                   /translation="MAIIPKNYARLESGYREKALKIYPWVCGRCSREFVYSNLRELTVH
FT                   HIDHDHTNNPEDGSNWELLCLYCHDHEHSKYTEADQYGTTVIAGEDAQKDVGEAKYNPF
FT                   ADLKAMMNKKK"
     MAIIPKNYAR LESGYREKAL KIYPWVCGRC SREFVYSNLR ELTVHHIDHD HTNNPEDGSN        60
     WELLCLYCHD HEHSKYTEAD QYGTTVIAGE DAQKDVGEAK YNPFADLKAM MNKKK            115
//

If you have problems or comments...

PBIL Back to PBIL home page