(data stored in ACNUC10821 zone)

EMBL: AP010958.YBAA

AP010958.YBAA        Location/Qualifiers
FT   CDS             485261..485614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaA"
FT                   /locus_tag="ECO103_0432"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0432"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29300"
FT                   /db_xref="InterPro:IPR009874"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2E2"
FT                   /protein_id="BAI29300.1"
FT                   /translation="MKYVDGFVVAVPADKKDAYREMAAKAAPLFKEFGALRIVECWASD
FT                   VPDGKVTDFRMAVKAEENEEVVFSWIEYPSKEVRDAATQKMMSDPRMKEFGESMPFDGK
FT                   RMIYGGFESIIDE"
     MKYVDGFVVA VPADKKDAYR EMAAKAAPLF KEFGALRIVE CWASDVPDGK VTDFRMAVKA        60
     EENEEVVFSW IEYPSKEVRD AATQKMMSDP RMKEFGESMP FDGKRMIYGG FESIIDE          117
//

If you have problems or comments...

PBIL Back to PBIL home page