(data stored in ACNUC10821 zone)

EMBL: AP010958.YBAB

AP010958.YBAB        Location/Qualifiers
FT   CDS             502665..502994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaB"
FT                   /locus_tag="ECO103_0447"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0447"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29315"
FT                   /db_xref="GOA:C8U2F7"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2F7"
FT                   /protein_id="BAI29315.1"
FT                   /translation="MFGKGGLGNLMKQAQQMQEKMQKMQEEIAQLEVTGESGAGLVKVT
FT                   INGAHNCRRVEIDPSLLEDDKEMLEDLVAAAFNDAARRIEETQKEKMASVSSGMQLPPG
FT                   FKMPF"
     MFGKGGLGNL MKQAQQMQEK MQKMQEEIAQ LEVTGESGAG LVKVTINGAH NCRRVEIDPS        60
     LLEDDKEMLE DLVAAAFNDA ARRIEETQKE KMASVSSGMQ LPPGFKMPF                   109
//

If you have problems or comments...

PBIL Back to PBIL home page