(data stored in SCRATCH zone)

EMBL: AP010958.YBAN

AP010958.YBAN        Location/Qualifiers
FT   CDS             499471..499848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaN"
FT                   /locus_tag="ECO103_0444"
FT                   /product="conserved predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0444"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29312"
FT                   /db_xref="GOA:C8U2F4"
FT                   /db_xref="InterPro:IPR007401"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2F4"
FT                   /protein_id="BAI29312.1"
FT                   /translation="MQRIILIIIGWLAVVLGTLGVVLPVLPTTPFILLAAWCFARSSPR
FT                   FHAWLLYRSWFGSYLRFWQKHHAMPRGVKPRAILLILLTFAISLWFVQMPWVRIMLLVI
FT                   LACLLFYMWRIPVIDEKQEKH"
     MQRIILIIIG WLAVVLGTLG VVLPVLPTTP FILLAAWCFA RSSPRFHAWL LYRSWFGSYL        60
     RFWQKHHAMP RGVKPRAILL ILLTFAISLW FVQMPWVRIM LLVILACLLF YMWRIPVIDE       120
     KQEKH                                                                   125
//

If you have problems or comments...

PBIL Back to PBIL home page