(data stored in ACNUC10821 zone)

EMBL: AP010958.YBAV

AP010958.YBAV        Location/Qualifiers
FT   CDS             472526..472897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaV"
FT                   /locus_tag="ECO103_0419"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0419"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29287"
FT                   /db_xref="GOA:C8U2C9"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004509"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2C9"
FT                   /protein_id="BAI29287.1"
FT                   /translation="MKHGIKALLITLSLACAGMSHSALAAASVAKPTTVETKAEAPAAQ
FT                   SKAAVPAKASDEEGTRVSINNASAEELARAMNGVGLKKAQAIVSYREEYGPFKTVEDLK
FT                   QVPGMGNSLVERNLAVLTL"
     MKHGIKALLI TLSLACAGMS HSALAAASVA KPTTVETKAE APAAQSKAAV PAKASDEEGT        60
     RVSINNASAE ELARAMNGVG LKKAQAIVSY REEYGPFKTV EDLKQVPGMG NSLVERNLAV       120
     LTL                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page