(data stored in ACNUC10821 zone)

EMBL: AP010958.YBAW

AP010958.YBAW        Location/Qualifiers
FT   CDS             472991..473389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaW"
FT                   /locus_tag="ECO103_0420"
FT                   /product="conserved predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0420"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29288"
FT                   /db_xref="GOA:C8U2D0"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2D0"
FT                   /protein_id="BAI29288.1"
FT                   /translation="MQTQIKVRGYHLDVYQHVNNARYLEFLEEARWDGLENSDSFQWMT
FT                   AHNIAFVVVNININYRRPAVLSDLLTITSQLQQLNGKSGILSQVITLEPEGQVVADALI
FT                   TFVCIDLKTQKALALEGELREKLEQMVK"
     MQTQIKVRGY HLDVYQHVNN ARYLEFLEEA RWDGLENSDS FQWMTAHNIA FVVVNININY        60
     RRPAVLSDLL TITSQLQQLN GKSGILSQVI TLEPEGQVVA DALITFVCID LKTQKALALE       120
     GELREKLEQM VK                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page