(data stored in ACNUC10821 zone)

EMBL: AP010958.YBAX

AP010958.YBAX        Location/Qualifiers
FT   CDS             complement(473441..474136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaX"
FT                   /locus_tag="ECO103_0421"
FT                   /product="predicted aluminum resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0421"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29289"
FT                   /db_xref="GOA:C8U2D1"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2D1"
FT                   /protein_id="BAI29289.1"
FT                   /translation="MKRAVVVFSGGQDSTTCLVQALQQYDEVHCVTFDYGQRHRAEIDV
FT                   ARELALKLGARAHKVLDVTLLNELAVSSLTRDSIPVPDYEPEADGIPNTFVPGRNILFL
FT                   TLAAIYAYQVKAEAVITGVCETDFSGYPDCRDEFVKALNHAVSLGMAKDIRFETPLMWI
FT                   DKAETWALADYYGKLDLVRNETLTCYNGIKGDGCGHCAACNLRANGLNHYLADKPTVMA
FT                   AMKQKTGLR"
     MKRAVVVFSG GQDSTTCLVQ ALQQYDEVHC VTFDYGQRHR AEIDVARELA LKLGARAHKV        60
     LDVTLLNELA VSSLTRDSIP VPDYEPEADG IPNTFVPGRN ILFLTLAAIY AYQVKAEAVI       120
     TGVCETDFSG YPDCRDEFVK ALNHAVSLGM AKDIRFETPL MWIDKAETWA LADYYGKLDL       180
     VRNETLTCYN GIKGDGCGHC AACNLRANGL NHYLADKPTV MAAMKQKTGL R                231
//

If you have problems or comments...

PBIL Back to PBIL home page