(data stored in ACNUC10821 zone)

EMBL: AP010958.YBBA

AP010958.YBBA        Location/Qualifiers
FT   CDS             528221..528907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbA"
FT                   /locus_tag="ECO103_0471"
FT                   /product="predicted transporter subunit"
FT                   /note="ATP-binding component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0471"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29339"
FT                   /db_xref="GOA:C8U2I1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2I1"
FT                   /protein_id="BAI29339.1"
FT                   /translation="MPAENIVEVHHLKKSVGQGEHELSILTGVELVVKRGETIALVGES
FT                   GSGKSTLLAILAGLDDGSSGEVSLVGQPLHNMDEEARAKLRAKHVGFVFQSFMLIPTLN
FT                   ALENVELPALLRGESSAESRNGAKALLEQLGLGKRLGHLPAQLSGGEQQRVALARAFNG
FT                   RPDVLFADEPTGNLDRQTGDKIADLLFSLNREHGTTLIMVTHDLQLAARCDRCLRLVNG
FT                   QLQEEA"
     MPAENIVEVH HLKKSVGQGE HELSILTGVE LVVKRGETIA LVGESGSGKS TLLAILAGLD        60
     DGSSGEVSLV GQPLHNMDEE ARAKLRAKHV GFVFQSFMLI PTLNALENVE LPALLRGESS       120
     AESRNGAKAL LEQLGLGKRL GHLPAQLSGG EQQRVALARA FNGRPDVLFA DEPTGNLDRQ       180
     TGDKIADLLF SLNREHGTTL IMVTHDLQLA ARCDRCLRLV NGQLQEEA                    228
//

If you have problems or comments...

PBIL Back to PBIL home page