(data stored in ACNUC10821 zone)

EMBL: AP010958.YBBJ

AP010958.YBBJ        Location/Qualifiers
FT   CDS             complement(522889..523344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbJ"
FT                   /locus_tag="ECO103_0464"
FT                   /product="conserved predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0464"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29332"
FT                   /db_xref="GOA:C8U2H4"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2H4"
FT                   /protein_id="BAI29332.1"
FT                   /translation="MELMVVHPHIFWLSLGGLLLAAEMLGGNGYLLWSGVAAVITGLVV
FT                   WLVPLGWEWQGVMFAILTLLAAWLWWKWLSRRVREQKHSDSHLNQRGQQLIGRRFVLES
FT                   PLVNGRGHMRVGDSSWPVSASEDLGAGTHVEVIAIEGITLHIRAVSS"
     MELMVVHPHI FWLSLGGLLL AAEMLGGNGY LLWSGVAAVI TGLVVWLVPL GWEWQGVMFA        60
     ILTLLAAWLW WKWLSRRVRE QKHSDSHLNQ RGQQLIGRRF VLESPLVNGR GHMRVGDSSW       120
     PVSASEDLGA GTHVEVIAIE GITLHIRAVS S                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page