(data stored in ACNUC10821 zone)

EMBL: AP010958.YBBL

AP010958.YBBL        Location/Qualifiers
FT   CDS             524407..525084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbL"
FT                   /locus_tag="ECO103_0466"
FT                   /product="predicted transporter subunit"
FT                   /note="ATP-binding component of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0466"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29334"
FT                   /db_xref="GOA:C8U2H6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2H6"
FT                   /protein_id="BAI29334.1"
FT                   /translation="MQENSPLLQLQNVGYLAGDAKILNNINFSLRAGEFKLITGPSGCG
FT                   KSTLLKIVASLISPTSGTLLFEGEDVSTLKPEIYRQQVSYCAQTPTLFGDTVYDNLIFP
FT                   WQIRNQQPDPAIFLDFLERFALPDSILTKNIAELSGGEKQRISLIRNLQFMPKVLLLDE
FT                   ITSALDESNKHNVNEMIHRYVREQNIAVLWVTHDKDEINHADKVITLQPHAGEMQEARY
FT                   ELA"
     MQENSPLLQL QNVGYLAGDA KILNNINFSL RAGEFKLITG PSGCGKSTLL KIVASLISPT        60
     SGTLLFEGED VSTLKPEIYR QQVSYCAQTP TLFGDTVYDN LIFPWQIRNQ QPDPAIFLDF       120
     LERFALPDSI LTKNIAELSG GEKQRISLIR NLQFMPKVLL LDEITSALDE SNKHNVNEMI       180
     HRYVREQNIA VLWVTHDKDE INHADKVITL QPHAGEMQEA RYELA                       225
//

If you have problems or comments...

PBIL Back to PBIL home page