(data stored in ACNUC10821 zone)

EMBL: AP010958.YBBM

AP010958.YBBM        Location/Qualifiers
FT   CDS             525071..525850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbM"
FT                   /locus_tag="ECO103_0467"
FT                   /product="predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0467"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29335"
FT                   /db_xref="GOA:C8U2H7"
FT                   /db_xref="InterPro:IPR005226"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2H7"
FT                   /protein_id="BAI29335.1"
FT                   /translation="MNSHNITNESLALALMLVVVAILISHKEKLALEKDIFWSVGRAII
FT                   QLIIVGYVLKYIFSVDDASLTLLMVLFICFNAAWNAQKRSKYIAKAFISSFIAITVGAG
FT                   ITLAVLILSGSIEFIPMQVIPIAGMIAGNAMVAVGLCYNNLGQRVISEQQQIQEKLSLG
FT                   ATPKQASAILIRDSIRAALIPTVDSAKTVGLVSLPGMMSGLIFAGIDPVKAIKYQIMVT
FT                   FMLLSTASLSTIIACYLTYRKFYNSRHQLVVTQLKKK"
     MNSHNITNES LALALMLVVV AILISHKEKL ALEKDIFWSV GRAIIQLIIV GYVLKYIFSV        60
     DDASLTLLMV LFICFNAAWN AQKRSKYIAK AFISSFIAIT VGAGITLAVL ILSGSIEFIP       120
     MQVIPIAGMI AGNAMVAVGL CYNNLGQRVI SEQQQIQEKL SLGATPKQAS AILIRDSIRA       180
     ALIPTVDSAK TVGLVSLPGM MSGLIFAGID PVKAIKYQIM VTFMLLSTAS LSTIIACYLT       240
     YRKFYNSRHQ LVVTQLKKK                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page