(data stored in ACNUC10821 zone)

EMBL: AP010958.YBCF

AP010958.YBCF        Location/Qualifiers
FT   CDS             557633..558526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybcF"
FT                   /locus_tag="ECO103_0493"
FT                   /product="predicted carbamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ECO103_0493"
FT                   /db_xref="EnsemblGenomes-Tr:BAI29360"
FT                   /db_xref="GOA:C8U2K2"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:C8U2K2"
FT                   /protein_id="BAI29360.1"
FT                   /translation="MKTLVVALGGNALLQRGEALTAENQYRNIASAVPALARLARSYRL
FT                   AIVHGNGPQVGLLALQNLAWKEVDPYPLDVLVAESQGMIGYMLAQSLSAQPQMPPVTTV
FT                   LTRIEVSPDDPAFLQPEKFIGPVYQPEEQKALEAAYGWQMKRDGKYLRRVVASPQPRKI
FT                   LDSEAIELLLKEGHVVICSGGGGVPVTEDGAGSEAVIDKDLAAALLAEQINADGLVILT
FT                   DADAVYENWGTPQQRAIRHATPDELAPFAKAYGSMGPKVTAVSGYVRSRGKPAWIGALS
FT                   RIEETLAGEAGTCISL"
     MKTLVVALGG NALLQRGEAL TAENQYRNIA SAVPALARLA RSYRLAIVHG NGPQVGLLAL        60
     QNLAWKEVDP YPLDVLVAES QGMIGYMLAQ SLSAQPQMPP VTTVLTRIEV SPDDPAFLQP       120
     EKFIGPVYQP EEQKALEAAY GWQMKRDGKY LRRVVASPQP RKILDSEAIE LLLKEGHVVI       180
     CSGGGGVPVT EDGAGSEAVI DKDLAAALLA EQINADGLVI LTDADAVYEN WGTPQQRAIR       240
     HATPDELAPF AKAYGSMGPK VTAVSGYVRS RGKPAWIGAL SRIEETLAGE AGTCISL          297
//

If you have problems or comments...

PBIL Back to PBIL home page